VEGF-CC Protein, Human (116a.a, HEK293)

VEGF-C Protein, Human (116a.a, HEK293) functions in lymphangiogenesis, where it acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth and migration.

The main function of VEGF-C is in lymphangiogenesis, where it acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth and migration^[1]. However, in addition to its effect on lymphatic vessels, it can also promote the growth of blood vessels and regulate their permeability. The effect on blood vessels can be mediated via its primary receptor VEGFR-3 or its secondary receptor VEGFR-2^[2]. Apart from vascular targets, VEGF-C is also important for neural development and blood pressure regulation^[3][4].

1.The ED₅₀ is <0.5 μg/mL as measured by HMVEC human microvascular endothelial cells.
2.Measured in a cell proliferation assay using HUVEC human microvascular endothelial cells. The ED₅₀ for this effect is ≤6.554 µg/mL, corresponding to a specific activity is ≥ 152.5 U/mg.

• 
  Measured in a cell proliferation assay using HUVEC human microvascular endothelial cells. The ED₅₀ for this effect is 6.554 µg/mL, corresponding to a specific activity is 152.5 U/mg.

Human

HEK293

Tag Free

P49767 (A112-R227)

7424  [NCBI]

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

16-19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Joukov V, et al. A novel vascular endothelial growth factor, VEGF-C, is a ligand for the Flt4 (VEGFR-3) and KDR (VEGFR-2) receptor tyrosine kinases. EMBO J. 1996 Jan 15;15(2):290-98.  [Content Brief]

  [2]. Tammela T, et al. Blocking VEGFR-3 suppresses angiogenic sprouting and vascular network formation Nature. 2008 Jul 31;454(7204):656-60.  [Content Brief]

  [3]. Le Bras B, et al. VEGF-C is a trophic factor for neural progenitors in the vertebrate embryonic brain. Nat Neurosci. 2006 Mar;9(3):340-8.  [Content Brief]

  [4]. Machnik A, et al. Macrophages regulate salt-dependent volume and blood pressure by a vascular endothelial growth factor-C-dependent buffering mechanism. Nat Med. 2009 May;15(5):545-52.  [Content Brief]