1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-D
  6. VEGF-DD Protein, Human (HEK293, His)

VEGF-DD protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-DD Protein, Human (HEK293, His) is the recombinant human-derived VEGF-DD protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF-DD Protein, Human (HEK293, His) is 109 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF-DD protein is a potent growth factor in angiogenesis, lymphangiogenesis, and endothelial cell growth, playing a key role in stimulating cell proliferation, migration, and affecting vascular permeability. It may be involved in the formation of veins and lymphatic vasculature during embryogenesis, suggesting that it plays a key role in vascular development. VEGF-DD Protein, Human (HEK293, His) is the recombinant human-derived VEGF-DD protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF-DD Protein, Human (HEK293, His) is 109 a.a., with molecular weight of ~18.0 kDa.

Background

The VEGF-DD Protein, a growth factor with prominent activity in angiogenesis, lymphangiogenesis, and endothelial cell growth, plays a pivotal role in stimulating the proliferation and migration of these cells, while also influencing blood vessel permeability. Its potential involvement in the formation of both venous and lymphatic vascular systems during embryogenesis suggests a critical role in vascular development. Additionally, VEGF-DD may contribute to the maintenance of differentiated lymphatic endothelium in adults. The protein achieves these effects through binding and activation of VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Structurally, VEGF-DD exists as a homodimer, displaying a non-covalent and antiparallel arrangement, highlighting its multifaceted role in regulating vascular processes and underscoring its importance in both developmental and adult angiogenesis and lymphangiogenesis.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.42 μg/mL, corresponding to a specific activity is 2.38×104 U/mg.

  • Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 0.42 μg/mL, corresponding to a specific activity is 2.38×104 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O43915 (F93-S201)

Gene ID
Molecular Construction
N-term
VEGF-DD (F93-S201)
Accession # O43915
6*His
C-term
Synonyms
Vascular Endothelial Growth Factor D; VEGF-D; c-Fos-Induced Growth Factor; FIGF; VEGFD
AA Sequence

FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS

Molecular Weight

Approximately 18.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

VEGF-DD Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF-DD Protein, Human (HEK293, His)
Cat. No.:
HY-P70495
Quantity:
MCE Japan Authorized Agent: