1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-D
  6. VEGF-DD Protein, Mouse (HEK293, Fc)

VEGF-DD Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-DD binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-DD is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-DD Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-DD protein, expressed by HEK293 , with N-hFc labeled tag. The total length of VEGF-DD Protein, Mouse (HEK293, Fc) is 109 a.a., with molecular weight of ~45 & 36 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF-DD Protein, a versatile growth factor, orchestrates angiogenesis, lymphangiogenesis, and endothelial cell growth. It stimulates proliferation, migration, and influences vessel permeability. VEGF-DD binds VEGFR-3, triggering crucial signaling for vascular development. Structurally, VEGF-DD is a non-covalent homodimer, emphasizing its intricate role in vascular processes. VEGF-DD Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VEGF-DD protein, expressed by HEK293 , with N-hFc labeled tag. The total length of VEGF-DD Protein, Mouse (HEK293, Fc) is 109 a.a., with molecular weight of ~45 & 36 kDa, respectively.

Background

VEGF-DD, a versatile growth factor, plays a pivotal role in angiogenesis, lymphangiogenesis, and endothelial cell growth by orchestrating processes such as proliferation, migration, and influencing blood vessel permeability. Its involvement spans critical phases, contributing to the formation of both venous and lymphatic vascular systems during embryogenesis, and maintaining the integrity of differentiated lymphatic endothelium in adults. Functionally, VEGF-DD binds to and activates the VEGFR-3 (Flt4) receptor, initiating essential signaling cascades for vascular development and homeostasis. Structurally, VEGF-DD exists as a homodimer, characterized by a non-covalent and antiparallel configuration, underscoring its intricate role in coordinating complex vascular phenomena.

Biological Activity

Measured by its ability to inhibit the proliferation of HUVEC cells. The ED50 for this effect is 0.3018 μg/mL, corresponding to a specific activity is 3.313×104 U/mg.

  • Measured by its ability to inhibit the proliferation of HUVEC cells. The ED50 for this effect is 0.3018 μg/mL, corresponding to a specific activity is 3.313×104U/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P97946 (F98-S206)

Gene ID
Molecular Construction
N-term
hFc
VEGF-DD (F98-S206)
Accession # P97946
C-term
Synonyms
Vascular endothelial growth factor D; VEGF-D; FIGF
AA Sequence

FYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYS

Molecular Weight

Approximately 42-50 kDa, due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF-DD Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF-DD Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73474
Quantity:
MCE Japan Authorized Agent: