1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF121 Protein, Human (120 a.a)

VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

Background

VEGF-121 lacks heparin binding ability and requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells[1]. In addition, VEGF-121 and VEGF 165 regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. VEGF-121 is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers[2][3]. Furthermore, VEGF-121 plasma level is biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma[4].

Biological Activity

1. The ED50 is ≤7.548 ng/mL as measured by HUVEC cells, corresponding to a specific activity of ≥1.32 × 105 units/mg.
2. Immobilized Human VEGF 121 at 2 μg/mL (100 μl/well) can bind Human VEGFR2-Fc.The ED50 of Human VEGFR2-Fc is ≤78 ng/mL.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 7.474 ng/mL, corresponding to a specific activity is 1.34×105 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P15692-9 (P28-R147)

Gene ID
Molecular Construction
N-term
VEGF121 (P28-R147)
Accession # P15692-9
C-term
Synonyms
VEGF-AA; rHuVEGF-121; VPF
AA Sequence

PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Molecular Weight

Approximately 17 kDa under reduced condition.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

VEGF121 Protein, Human (120 a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF121 Protein, Human (120 a.a)
Cat. No.:
HY-P7420
Quantity:
MCE Japan Authorized Agent: