2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. VEGF & VEGFR
  5. VEGF
  6. VEGF-A
  7. VEGF145 Protein, Human (HEK293)

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free.
Background

VEGF145 Protein, characterized by limited expression, is not widely distributed across tissues or cell types. The restricted occurrence of VEGF145 suggests a specialized and possibly context-specific role in physiological processes. Further investigation is warranted to uncover the specific cellular contexts and functions in which VEGF145 is actively involved, shedding light on its potential contributions to localized biological activities.
Species

Human
Source

HEK293
Accession

P15692-6 (A27-R171)
Gene ID

7422
Molecular Construction
N-term
VEGF145 (A27-R171)
Accession # P15692-6
C-term
Synonyms
VEGF-AA; MVCD1; VAS; Vascular endothelial growth factor A; VEGF; VPF
AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Predicted Molecular Mass
16.9 kDa
Molecular Weight

Approximately 19-23 kDa band in SDS-PAGE under reducing conditions due to the glycosylation.
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

VEGF145 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF145 Protein, Human (HEK293)
Cat. No.:
HY-P73556A
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.