1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF164 Protein, Rat (P.pastoris)

The VEGF164 protein is a growth factor critical for vasculogenesis, vasculogenesis, and endothelial cell growth, inducing proliferation, promoting migration, inhibiting apoptosis, and enhancing vascular permeability. It binds to FLT1/VEGFR1, KDR/VEGFR2, heparan sulfate, heparin, NRP1 and DEAR/FBXW7-AS1 receptors. VEGF164 Protein, Rat (P.pastoris) is the recombinant rat-derived VEGF164 protein, expressed by P. pastoris , with tag free. and A36T, , , , mutation. The total length of VEGF164 Protein, Rat (P.pastoris) is 164 a.a., with molecular weight of 18-23 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VEGF164 protein is a growth factor critical for vasculogenesis, vasculogenesis, and endothelial cell growth, inducing proliferation, promoting migration, inhibiting apoptosis, and enhancing vascular permeability. It binds to FLT1/VEGFR1, KDR/VEGFR2, heparan sulfate, heparin, NRP1 and DEAR/FBXW7-AS1 receptors. VEGF164 Protein, Rat (P.pastoris) is the recombinant rat-derived VEGF164 protein, expressed by P. pastoris , with tag free. and A36T, , , , mutation. The total length of VEGF164 Protein, Rat (P.pastoris) is 164 a.a., with molecular weight of 18-23 kDa.

Background

VEGF164, a growth factor with pivotal roles in angiogenesis, vasculogenesis, and endothelial cell growth, orchestrates a range of cellular responses crucial for vascular development. It stimulates endothelial cell proliferation, facilitates cell migration, prevents apoptosis, and enhances blood vessel permeability by binding to receptors such as FLT1/VEGFR1 and KDR/VEGFR2, as well as heparan sulfate and heparin. During lactation, VEGF164 may contribute to increased vascular permeability, supporting efficient transport of molecules for milk protein synthesis. Additionally, its interaction with the NRP1 receptor initiates signaling pathways essential for motor neuron axon guidance and cell migration, underscoring its involvement in embryonic development processes. Existing as a homodimer with disulfide linkage, VEGF164 also forms a heterodimer with PGF and interacts with isoform 2 of BSG, revealing its multifaceted molecular interactions.

Species

Rat

Source

P. pastoris

Tag

Tag Free

Accession

P16612-2 (A27-R190, A36T)

Gene ID
Molecular Construction
N-term
VEGF164 (A27-R190, A36T)
Accession # P16612-2
C-term
Synonyms
VEGF-AA; Vascular endothelial growth factor A; Vascular permeability factor; VEGF; VPF
AA Sequence

APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Weight

18-23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

VEGF164 Protein, Rat (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF164 Protein, Rat (P.pastoris)
Cat. No.:
HY-P70638
Quantity:
MCE Japan Authorized Agent: