VEGF165 Protein, Human (HEK293, C-His)

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF165 Protein, Human (HEK293, C-His) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of VEGF165 Protein, Human (HEK293, C-His) is 165 a.a., with molecular weight of 20-23 kDa.

VEGF145 Protein, characterized by limited expression, is not widely distributed across tissues or cell types. The restricted occurrence of VEGF145 suggests a specialized and possibly context-specific role in physiological processes. Further investigation is warranted to uncover the specific cellular contexts and functions in which VEGF145 is actively involved, shedding light on its potential contributions to localized biological activities.

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ this effect is 2.929 ng/ml, corresponding to a specific activity is 3.41×10^5 units/mg.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 2.929 ng/mL, corresponding to a specific activity is 3.41×10⁵ units/mg.

Human

HEK293

C-10*His

P15692-4 (A27-R191)

7422  [NCBI]

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

20-23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.