VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi)

VEGF145 Protein, with limited expression, exhibits specialized distribution and is not broadly present in tissues. Its restricted occurrence implies a specific, context-dependent role in physiological processes. Further research is needed to unveil the specific cellular contexts and functions where VEGF145 actively participates, providing insights into its potential contributions to localized biological activities. VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of VEGF165 Protein, Human (Biotinylated, HEK293, His-Avi) is 165 a.a., with molecular weight of 28-32 kDa.

VEGF145 Protein, characterized by limited expression, is not widely distributed across tissues or cell types. The restricted occurrence of VEGF145 suggests a specialized and possibly context-specific role in physiological processes. Further investigation is warranted to uncover the specific cellular contexts and functions in which VEGF145 is actively involved, shedding light on its potential contributions to localized biological activities.

1.Immobilized Biotinylated Human VEGF165 at 0.2 μg/mL (100μL/Well) on the plate. Dose response curve for Anti-VEGF165 Antibody hFc with the EC₅₀ of 20.4 ng/mL determined by ELISA.
2.Immobilized Anti-VEGF165 Antibody at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human VEGF165, His Tag with the EC₅₀ of ≤15 ng/mL determined by ELISA.

Human

HEK293

C-Avi;C-His

P15692-4 (A27-R191)

7422  [NCBI]

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERR

28-32 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.