VEGF164 Protein, Mouse

VEGF164 Protein, Mouse is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

VEGF164 was found to be significantly more potent at inducing inflammation. In vivo blockade of VEGF receptor (VEGFR)-1 significantly suppressed VEGF164-induced corneal inflammation. In vitro, VEGF164 more potently stimulated intracellular adhesion molecule (ICAM)-1 expression on endothelial cells, an effect that was mediated by VEGFR2. VEGF164 was also more potent at inducing the chemotaxis of monocytes, an effect that was mediated by VEGFR1. In an immortalized human leukocyte cell line, VEGF164 was found to induce tyrosine phosphorylation of VEGFR1 more efficiently^[1]. VEGF164 is an important isoform in the pathogenesis of early diabetic retinopathy^[2].

The ED₅₀ is <5 ng/mL as measured by human umbilical vein endothelial cells(HUVEC), corresponding to a specific activity of >2.0 × 10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 3.5 ng/mL, corresponding to a specific activity is 2.86×10⁵ units/mg.

Mouse

E. coli

Tag Free

Q00731-2 (A27-R190)

22339  [NCBI]

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 38.8 kDa (Disulfide-linked homodimer) as determined by no-reducing SDS-PAGE; approximately 20 kDa as determined by reducing SDS-PAGE.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 6.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Usui T, et al. VEGF164(165) as the pathological isoform: differential leukocyte and endothelial responses through VEGFR1 and VEGFR2. Invest Ophthalmol Vis Sci. 2004 Feb;45(2):368-74.  [Content Brief]

  [2]. Ishida S,et al. VEGF164 is proinflammatory in the diabetic retina. Invest Ophthalmol Vis Sci. 2003 May;44(5):2155-62.  [Content Brief]