VEGF-AA Protein, Canine (HEK293)

VEGFA Protein is a vascular endothelial growth factor that is active in angiogenesis and endothelial cell growth. VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability. VEGFA Protein consists of 214 amino acids (M1-R214). VEGF-AA Protein, Canine (HEK293) is the recombinant canine-derived VEGF-AA protein, expressed by HEK293 , with tag free. The total length of VEGF-AA Protein, Canine (HEK293) is 190 a.a., with molecular weight of ~23 kDa.

VEGFA Protein has activity in angiogenesis and endothelial cell growth.
VEGFA Protein induces endothelial cell proliferation, promotes cell migration, inhibits cell apoptosis, and induces vascular permeability.
VEGFA Protein can bind to receptors such as FLT1/VEGFR1 and KDR/VEGFR2, receptors such as DEAR/FBXW7-AS1, and sulfated acetylheparins and heparins.
The binding of VEGFA protein to NRP1 receptor initiates the signaling pathways required for motor neuron axon guidance and cell body migration, including the migration of facial motor neurons from rhomboid 4 to the tail of rhomboid 6 during embryonic development.
VEGF-A Protein is involved in the progression and malignant transformation of canine mastocytoma (MCT)

1.Immobilized canine VEGF164/VEGFA at 10 μg/mL (100 μL/well) can bind human VEGFR2-Fc and the EC₅₀ is 33.83-78.95 ng/mL.
2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED₅₀ for this effect is typically 2-12 ng/mL.

Canine

HEK293

Tag Free

NP_001103972.1 (M1-R190)

403802  [NCBI]

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 23 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.