1. Recombinant Proteins
  2. Others
  3. Versican Isoform V0 Protein, Human (His, B2M, Myc)

Versican Isoform V0 Protein, Human (His, B2M, Myc)

Cat. No.: HY-P702616
Handling Instructions Technical Support

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli.

Background

Versican Isoform V3 protein is implicated in intercellular signaling and the dynamic interaction between cells and the extracellular matrix. It likely contributes to the intricate regulation of cellular processes such as motility, growth, and differentiation. A notable feature of Versican Isoform V3 is its ability to bind hyaluronic acid, suggesting a potential role in modulating the extracellular microenvironment. Furthermore, its interaction with FBLN1 highlights its involvement in intricate molecular networks, emphasizing its significance in mediating cellular responses and maintaining tissue homeostasis.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

  • Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.
Species

Human

Source

E. coli

Tag

N-B2M;C-Myc;N-10*His

Accession

P13611-1 (G3089-N3354)

Gene ID

1462

Molecular Construction
N-term
10*His-B2M
VCAN (G3089-N3354)
Accession # P13611-1
Myc
C-term
Synonyms
Versican core protein; VCAN; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan 2; Glial hyaluronate-binding protein; GHAP; Large fibroblast proteoglycan; PG-M; CSPG2
AA Sequence

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Molecular Weight

Approximately 50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Versican Isoform V0 Protein, Human (His, B2M, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Versican Isoform V0 Protein, Human (His, B2M, Myc)
Cat. No.:
HY-P702616
Quantity:
MCE Japan Authorized Agent: