Versican Isoform V0 Protein, Human (His, B2M, Myc)

Versican Isoform V3 Protein, involved in intercellular signaling, connects cells to the extracellular matrix, regulating cell motility, growth, and differentiation. It binds hyaluronic acid and interacts with FBLN1. Versican Isoform V0 Protein, Human (His, B2M, Myc) is the recombinant human-derived Versican Isoform V0, expressed by E. coli.

Versican Isoform V3 protein is implicated in intercellular signaling and the dynamic interaction between cells and the extracellular matrix. It likely contributes to the intricate regulation of cellular processes such as motility, growth, and differentiation. A notable feature of Versican Isoform V3 is its ability to bind hyaluronic acid, suggesting a potential role in modulating the extracellular microenvironment. Furthermore, its interaction with FBLN1 highlights its involvement in intricate molecular networks, emphasizing its significance in mediating cellular responses and maintaining tissue homeostasis.

Measured by the ability of the immobilized protein to support the adhesion of HUVEC Human umbilical vein endothelial cells. 5 μg/mL of Recombinant Human Versican Isoform V0 can effectively promote adhesion.

Human

E. coli

N-B2M;C-Myc;N-10*His

P13611-1 (G3089-N3354)

1462

GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Approximately 50 kDa

Greater than 95 % as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.