1. Recombinant Proteins
  2. Others
  3. Vitronectin Protein, Human (HEK293, His)

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Vitronectin Protein, Human (HEK293, His) is 459 a.a., with molecular weight of 60-80 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Vitronectin Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

Publications Citing Use of MCE Vitronectin Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (HEK293, His) is the recombinant human-derived Vitronectin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Vitronectin Protein, Human (HEK293, His) is 459 a.a., with molecular weight of 60-80 kDa.

Background

Vitronectin Protein is a multifunctional cell adhesion and spreading factor present in serum and tissues. It interacts with glycosaminoglycans and proteoglycans and acts as a cell-to-substrate adhesion molecule, binding to specific integrins. Additionally, Vitronectin Protein functions as an inhibitor of the terminal cytolytic complement pathway, protecting cell membranes from damage. It also possesses protease-inhibiting activity and is involved in regulating growth hormone-dependent processes, specifically somatomedin-B.

Biological Activity

1.Immobilized Human Vitronectin, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Mouse ITGAV&ITGB3, His Tag with the EC50 of ≤1.72 μg/mL determined by ELISA.
2.Measured by the ability of the immobilized protein to support the adhesion of B16-F1 mouse melanoma cells. When 5x104 cells/well are added to Vitronectin coated plates (5 µg/mL with 100 µL/well), approximately is >78% will adhere after 30 minutes at 37°C.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P04004/AAH05046.1 (D20-L478)

Gene ID
Molecular Construction
N-term
Vitronectin (D20-L478)
Accession # P04004
6*His
C-term
Synonyms
Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN
AA Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Molecular Weight

Approximately 60-80 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Vitronectin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vitronectin Protein, Human (HEK293, His)
Cat. No.:
HY-P70485
Quantity:
MCE Japan Authorized Agent: