1. Recombinant Proteins
  2. Others
  3. VMO1 Protein, Human (HEK293, His)

VMO1 Protein, Human (HEK293, His)

Cat. No.: HY-P71422
Handling Instructions

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, His) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen鈥檚 eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. VMO1 is a secreted protein and exerts important functions in inner ear and tear film, VMO1 may also interact with glycosylated proteins. VMO1 Protein, Human (HEK293, His) is the recombinant human-derived VMO1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Vitelline membrane outer layer protein 1 homolog (VMO1) is first characterized in the outer layer of the vitelline membrane of hen’s eggs, where VMO1is present together with lysozyme, VMO2, and ovomucin. Determination of the crystal structure of VMO1 revealed that VMO1 may interact with glycosylated proteins.VMO1 is a secreted protein and exerts important functions in inner ear and tear film[1].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q7Z5L0-1 (Q25-S202)

Gene ID
Molecular Construction
N-term
VMO1 (Q25-S202)
Accession # Q7Z5L0-1
6*His
C-term
Synonyms
Vitelline Membrane Outer Layer Protein 1 Homolog; VMO1
AA Sequence

QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRS

Molecular Weight

18-22 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

VMO1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VMO1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71422
Quantity:
MCE Japan Authorized Agent: