1. Recombinant Proteins
  2. Others
  3. VSIG2 Protein, Human (HEK293, His)

VSIG2 is also known as CTXL (cortical thymocyte like-protein). VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VSIG2 is also known as CTXL (cortical thymocyte like-protein). VSIG2 promotes malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VSIG2 can be used as a potential biomarker or therapeutic target for tumors. VSIG2 Protein, Human (HEK293, His) is the recombinant human-derived VSIG2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

V-set and immunoglobulin domain-containing protein 2, also known as corticothymocyte-like protein, CT-like protein and VSIG2, is a single-generation type I membrane protein. VSIG2 is highly expressed in the stomach and colon and weakly expressed in the bladder and lungs. VSIG2 is associated with immune invasion and antigen presentation of colon cancer (COAD), and it can be used as a potential biomarker or therapeutic target for COAD. VSIG2 promotes the malignant progression of pancreatic ductal adenocarcinoma through LAMtor2-mediated mTOR activation. VISG2 has been associated with a variety of diseases, in corneal samples from Fuchs patients with endothelial corneal dystrophy (FECD), in intestinal biopsies from patients with irritable bowel syndrome (IBS-D), in plasma from patients with acute tubule injury and interstitial fibrosis/tubular atrophy, and in plasma from patients with sudden heart failure. VSIG2 was found to be significantly upregulated[1][2][3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96IQ7-1 (V24-A243)

Gene ID
Molecular Construction
N-term
VSIG2 (V24-A243)
Accession # Q96IQ7-1
6*His
C-term
Synonyms
V-Set and Immunoglobulin Domain-Containing Protein 2; Cortical Thymocyte-Like Protein; CT-Like Protein; VSIG2; CTH; CTXL
AA Sequence

VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA

Molecular Weight

29-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VSIG2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSIG2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70503
Quantity:
MCE Japan Authorized Agent: