WBP1 Protein, Human (His)

WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.

The WBP1 protein engages in specific molecular interactions, including its binding to NEDD4, revealing a potential regulatory connection in cellular processes. Furthermore, WBP1 establishes interactions with the WW domains of YAP1, WWP1, and WWP2, suggesting its involvement in signaling pathways associated with these domains. Additionally, WBP1 interacts with WWOX, further expanding its potential roles in cellular functions and regulatory networks. These interactions emphasize the multifaceted nature of WBP1, prompting further investigation into the precise mechanisms and functional implications of its associations with these proteins.

Human

E. coli

N-6*His

Q96G27 (G170-P269)

23559  [NCBI]

GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP

Approximately 20.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.