1. Recombinant Proteins
  2. Others
  3. WBP1 Protein, Human (His)

WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

WBP1 protein interacts with NEDD4, indicating a regulatory connection.It also engages with the WW domains of YAP1, WWP1, and WWP2, implicating its role in related signaling pathways.Additionally, WBP1 interacts with WWOX, showcasing its multifaceted involvement in cellular functions and regulatory networks.Further exploration is needed to understand the specific mechanisms and functional implications of these associations.WBP1 Protein, Human (His) is the recombinant human-derived WBP1 protein, expressed by E.coli , with N-6*His labeled tag.

Background

The WBP1 protein engages in specific molecular interactions, including its binding to NEDD4, revealing a potential regulatory connection in cellular processes. Furthermore, WBP1 establishes interactions with the WW domains of YAP1, WWP1, and WWP2, suggesting its involvement in signaling pathways associated with these domains. Additionally, WBP1 interacts with WWOX, further expanding its potential roles in cellular functions and regulatory networks. These interactions emphasize the multifaceted nature of WBP1, prompting further investigation into the precise mechanisms and functional implications of its associations with these proteins.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q96G27 (G170-P269)

Gene ID
Molecular Construction
N-term
6*His
WBP1 (G170-P269)
Accession # Q96G27
C-term
Synonyms
WW Domain-Binding Protein 1; WBP-1; WBP1
AA Sequence

GTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

WBP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
WBP1 Protein, Human (His)
Cat. No.:
HY-P71430
Quantity:
MCE Japan Authorized Agent: