1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. C Chemokines
  5. XCL1
  6. XCL1 Protein, Rat (His)

XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of XCL1 Protein, Rat (His) is 93 a.a., with molecular weight of ~13 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

XCL1 protein attracts lymphocytes but not monocytes or neutrophils. It plays a crucial role in accumulating dendritic cells in the thymus medulla and contributes to regulatory T cell development, establishing self-tolerance. XCL1 Protein, Rat (His) is the recombinant rat-derived XCL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of XCL1 Protein, Rat (His) is 93 a.a., with molecular weight of ~13 kDa.

Background

XCL1 protein exhibits chemotactic activity specifically for lymphocytes while not attracting monocytes or neutrophils. In the thymus, it plays a crucial role in mediating the accumulation of dendritic cells in the medulla and contributes to the development of regulatory T cells, thus playing a vital role in establishing self-tolerance.

Biological Activity

Measured by its ability to chemoattract Jurkat cells. The ED50 this effect is 27.03 ng/mL, corresponding to a specific activity is 3.70×104 units/mg.

  • Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 27.03 ng/ml, corresponding to a specific activity is 3.70×104 units/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

P51672 (V22-G114)

Gene ID
Molecular Construction
N-term
6*His
XCL1 (V22-G114)
Accession # P51672
C-term
Synonyms
Xcl1; Ltn; Scyc1; Lymphotactin; C motif chemokine 1; Cytokine SCM-1; Small-inducible cytokine C1
AA Sequence

VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

XCL1 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
XCL1 Protein, Rat (His)
Cat. No.:
HY-P71947A
Quantity:
MCE Japan Authorized Agent: