XTP3TPA Protein, Human (His)

XTP3TPA protein crucially hydrolyzes deoxynucleoside triphosphates (dNTPs), particularly preferring dCTP and its analogs, like 5-iodo-dCTP and 5-methyl-dCTP. This selective hydrolysis, reflecting high efficiency, likely safeguards against the incorporation of genotoxic nucleotide analogs into DNA or RNA, contributing to genomic integrity and protecting cellular nucleotide pools. XTP3TPA Protein, Human (His) is the recombinant human-derived XTP3TPA protein, expressed by E. coli , with N-His labeled tag.

XTP3TPA protein plays a crucial role in cellular processes by hydrolyzing deoxynucleoside triphosphates (dNTPs) to their corresponding nucleoside monophosphates. This enzyme exhibits a robust preference for dCTP and its analogs, such as 5-iodo-dCTP and 5-methyl-dCTP, showcasing high efficiency, possibly serving as a protective mechanism against the incorporation of genotoxic nucleotide analogs into DNA or RNA. The selective hydrolysis of these nucleotide triphosphates by XTP3TPA contributes to the maintenance of genomic integrity and may play a role in safeguarding cellular nucleotide pools from potentially harmful analogs.

Human

E. coli

N-His

Q9H773 (M1-T170)

79077  [NCBI]

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.