1. Recombinant Proteins
  2. Others
  3. ZG16 Protein, Human (HEK293, His)

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ZG16 Protein, Human (HEK293, His) is 151 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ZG16 protein has a potential role in protein transport and serves as a linker molecule during trans-Golgi network (TGN) particle formation. Its involvement suggests a dynamic role in intracellular protein transport. ZG16 Protein, Human (HEK293, His) is the recombinant human-derived ZG16 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ZG16 Protein, Human (HEK293, His) is 151 a.a., with molecular weight of ~16.0 kDa.

Background

ZG16 protein is implicated in potentially playing a role in protein trafficking, specifically functioning as a linker molecule during granule formation within the trans-Golgi network (TGN). Its potential involvement in protein trafficking suggests a role in the dynamic process of transporting proteins within the cell. Notably, ZG16 may act as a crucial linker between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins, emphasizing its significance in the intricate process of granule formation. The precise mechanisms and molecular interactions through which ZG16 orchestrates protein trafficking and facilitates granule formation merit further investigation to elucidate its functional contributions in cellular processes related to protein transport and secretion.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O60844 (N17-C167)

Gene ID
Molecular Construction
N-term
ZG16 (N17-C167)
Accession # O60844
6*His
C-term
Synonyms
Zymogen Granule Membrane Protein 16; Zymogen Granule Protein 16; hZG16; Secretory Lectin ZG16; ZG16
AA Sequence

NAIQARSSSYSGEYGGGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLLFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPSSCSRC

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ZG16 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZG16 Protein, Human (HEK293, His)
Cat. No.:
HY-P71037
Quantity:
MCE Japan Authorized Agent: