Zika virus E/Envelope Protein (Biotinylated, HEK293, His)

Genome polyprotein is a smaller protein chain of covalent linkages that is a key component of virus survival and replication. Zika virus E/Envelope Protein (Biotinylated, HEK293, His) is the recombinant virus-derived Zika virus E/Envelope, expressed by HEK293 , with C-His labeled tag.

Genome polyprotein is a series of protein units with similar or different functions that have been widely utilized by single-celled or multi-cellular organisms as concentrators of countless molecular activities. Genome polyprotein is a small protein chain that is covalently linked, and it is a common means of organizing the protein set of viruses (including HIV) in nature. As the signal peptide of NS4B, genome polyprotein is essential for the anti-interferon activity of NS4B. Genome polyprotein inhibits RNA silencing by interfering with host Dicer. Genome polyprotein may play a role in viral budding. Genome polyprotein exerts cytotoxic effects by activating the mitochondrial apoptosis pathway through the M ectodomain. Genome polyprotein may display viral protein activity^[1][2].

Virus

HEK293

C-His

ALU33341 (V593-K699)

/

VSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGK

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.