1. Recombinant Proteins
  2. Others
  3. ZNF75A Protein, Human (His)

The ZNF75A protein appears to be a potential influencer of transcriptional regulation, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF75A are not fully understood, its multifunctional nature in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF75A Protein, Human (His) is the recombinant human-derived ZNF75A protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNF75A Protein, Human (His) is 105 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ZNF75A protein appears to be a potential influencer of transcriptional regulation, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF75A are not fully understood, its multifunctional nature in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF75A Protein, Human (His) is the recombinant human-derived ZNF75A protein, expressed by E. coli , with N-6*His labeled tag. The total length of ZNF75A Protein, Human (His) is 105 a.a., with molecular weight of ~14.0 kDa.

Background

The ZNF75A protein emerges as a potential contributor to transcriptional regulation, suggesting its likely involvement in modulating gene expression. While the specific mechanisms and target genes influenced by ZNF75A remain to be fully elucidated, its association with transcriptional processes implies a role in shaping cellular functions through the control of gene expression. The versatile nature of ZNF75A within the realm of transcriptional regulation hints at its potential impact on diverse cellular pathways, making it a compelling candidate for further investigation to unravel its role in the intricate dynamics of gene regulation and the maintenance of cellular homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q96N20 (S58-K162)

Gene ID

7627  [NCBI]

Molecular Construction
N-term
6*His
ZNF75A (S58-K162)
Accession # Q96N20
C-term
Synonyms
Zinc Finger Protein 75A; ZNF75A
AA Sequence

SPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFK

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ZNF75A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZNF75A Protein, Human (His)
Cat. No.:
HY-P71442
Quantity:
MCE Japan Authorized Agent: