ZNRF3 Protein, Human (HEK293, His)

ZNRF3, as an E3 ubiquitin protein ligase, plays a crucial role as a negative regulator in the Wnt signaling pathway. It does this by mediating the ubiquitination and subsequent degradation of components within the Wnt receptor complex, namely Frizzled and LRP6. ZNRF3 Protein, Human (HEK293, His) is the recombinant human-derived ZNRF3 protein, expressed by HEK293 , with C-6*His labeled tag.

ZNRF3 is an E3 ubiquitin-protein ligase that functions as a crucial negative regulator of the Wnt signaling pathway. By mediating the ubiquitination and subsequent degradation of key components in the Wnt receptor complex, including Frizzled and LRP6, ZNRF3 plays a pivotal role in modulating both canonical and non-canonical Wnt signaling pathways. Particularly, in the intestinal stem cell zone, ZNRF3 acts as a tumor suppressor by inhibiting Wnt signaling, thereby restricting the size of the intestinal stem cell zone. This regulatory function underscores its significance in controlling cellular processes. In conjunction with RSPO2 and RNF43, ZNRF3 constitutes a master switch governing limb specification, highlighting its broader involvement in developmental pathways.

Measured by its binding ability in a functional ELISA. Immobilized ZNRF3 Protein, Human (HEK293, His) at 5 μg/mL can bind Human RSPO2, the ED₅₀ is ≤10 ng/mL.

Human

HEK293

C-6*His

Q9ULT6-1 (K56-M219)

84133  [NCBI]

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Approximately 21 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.