Search Result

Search Result

Results for "

Exendin-4

" in MedChemExpress (MCE) Product Catalog:

By Targets:	GCGR (10) GLP Receptor (1)
By Research Areas:	Cancer (3) Cardiovascular Disease (3) Endocrinology (1) Metabolic Disease (9) Neurological Disease (1)

11

Inhibitors & Agonists

11

Peptides

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

Exendin-4 50+ Cited Publications Exenatide	GCGR	Cardiovascular Disease Metabolic Disease Cancer
Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC₅₀ of 3.22 nM.

Exendin-4 acetate 50+ Cited Publications Exenatide acetate	GCGR	Cardiovascular Disease Metabolic Disease Cancer
Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC₅₀ of 3.22 nM.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Exendin-3/4 (59-86)	GCGR	Metabolic Disease
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.

*{Val1}-Exendin-3/4*	GCGR	Metabolic Disease
{Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide.

Exendin-4 (3-39)	GCGR	Neurological Disease Endocrinology
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis .

Exendin-4-Lys-azide TFA	GCGR	Cardiovascular Disease Metabolic Disease Cancer
Exendin-4-Lys-azide TFA (Compound Ex40) is an azide derivative of Exendin-4-Lys-azide, Exendin-4, which can be used for coupling/click chemistry .

Exendin 4, biotin labeled	GCGR	Others
Exendin 4, biotin labeled is a biological active peptide. (Biotin labeled HY-13443)

*Des His1, Glu8 Exendin-4*	GCGR	Metabolic Disease
Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal .

Albenatide CJC 1134PC	GLP Receptor	Metabolic Disease
Albenatide (CJC 1134PC) is a modified Exendin-4 (HY-13443) analogue conjugated to human recombinant albumin (HRA) in vitro to form a long-acting DPP-4-resistant GLP-1R agonist. Albenatide covalently binds through a low-molecular chemical linker (cys-C13H19O6N3-lys) to the cysteine residue in position 34 of HRA. Albenatide increases cyclic AMP (cAMP) production in vitro. Albenatide reduces glucose excursions, food intake, gastric emptying in wild-type mice and improves glucose tolerance and reduces body weight in high-fat diet mice .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

MedChemExpress Magic Cece

MedChemExpress: Contact Us; About Us; Headquarters; Distributors; Statement on False Report; Careers

Customer Support: Technical Support; Service; Ordering Information; Easy Return; Shipping Rates & Policies; Intellectual Property Promise

Resources: Free Sample; Resources; Molarity Calculator; Dilution Calculator; Terms & Conditions; Reconstitution Calculator; Specific Activity Calculator; DNA/RNA sequence conversion tools

Subscribe to our E-newsletter

Name
Email *

	Sorry, but the email address you supplied was invalid.

Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.

Copyright © 2013-2025 MedChemExpress. All Rights Reserved.: Site Map Privacy Policy

Join with us