1. Anti-infection
  2. Bacterial
  3. Sortase A, S. aureus

Sortase A, S. aureus (SrtA), a transpeptidase enzyme is present in many Gram-positive bacteria and helps in the recruitment of the cell surface proteins. Sortase A, S. aureus plays an important part in ligation of various molecules on the cell surfaces.

For research use only. We do not sell to patients.

Sortase A, S. aureus Chemical Structure

Sortase A, S. aureus Chemical Structure

CAS No. : 9033-39-0

Size Price Stock
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Sortase A, S. aureus (SrtA), a transpeptidase enzyme is present in many Gram-positive bacteria and helps in the recruitment of the cell surface proteins. Sortase A, S. aureus plays an important part in ligation of various molecules on the cell surfaces[1].

In Vitro

The product can be diluted with sterile pure water to 0.5 μg/μL as the working solution.

Preparation of polypeptide reaction system (30 μL system)
1. Test group: 5 μL Srt3 (1 mM), 5 μL Srt4 (1 mM), 5 μL Sortase A (0.5 μg/μL), 10 μL 3× reaction Buffer, 5 μL ddH2O;
2. Control group: 5 μL Srt3 (1 mM), 5 μL Srt4 (1 mM), 20 μL ddH2O
Prepare the corresponding control group and test group in turn according to the above table. After the preparation, take the test group reagent, mix it evenly, centrifuge it, and react it at 30°C for 1-3h. After the reaction is completed, perform SDS-PAGE electrophoresis on the control group and the test group simultaneously.

Notes
1.3×Reaction Buffer: 100 mM Tris-HCl 7.5, 50 mM CaCl2, 20 mM DTT
2.Synthetic peptides are used for performance reaction.
The peptide sequence is as follows:
SrtA-3 YGVRLCGREFIRAVIFTCGGSRWRRKGGLPRTGG 34
SrtA-4 GGGGSGGRRSRRSRQDLQTLCCTDGCSMTDLSALC 35
It is recommended to divide the synthesized peptide into small tubes. Sterile purified water can be used to dissolve the peptide. It is recommended to prepare it before use.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

CAS No.
Appearance

Liquid

Color

Colorless to light yellow

SMILES

[Sortase A, S. aureus]

Shipping

Shipping with dry ice.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Purity: 95.00%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Sortase A, S. aureus Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Sortase A, S. aureus
Cat. No.:
HY-E70234
Quantity:
MCE Japan Authorized Agent: