Super-TDU (1-31) (TFA)

Cat. No.: HY-P1728A Purity: 99.27%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Super-TDU (1-31) TFA is a peptide fragment of Super-TDU. Super-TDU (1-31) TFA is an inhibitor of YAP-TEAD complex. Super-TDU TFA shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model.

For research use only. We do not sell to patients.

Super-TDU (1-31) (TFA) Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Super-TDU (1-31) (TFA):

Super-TDU (1-31) Get quote

2 Publications Citing Use of MCE Super-TDU (1-31) (TFA)

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

Super-TDU (1-31) TFA (50 nM; 24-72 hours) can largely compromise the increased cell viability induced by ACTN1 in Huh-7 or LM3 cells proliferation^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Viability Assay^[2]

Cell Line:	Liver cancer cell lines of human, including Huh-7, LM3 cells
Concentration:	50 nM
Incubation Time:	24, 48 and 72 h
Result:	Could largely compromise the increased cell viability induced by ACTN1.

Molecular Weight

3355.50

Formula

C₁₄₁H₂₁₈N₄₀O₄₈.C₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence Shortening

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQT

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (14.90 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2980 mL	1.4901 mL	2.9802 mL
5 mM	0.0596 mL	0.2980 mL	0.5960 mL
10 mM	0.0298 mL	0.1490 mL	0.2980 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 99.27%

Select Batch:

Data Sheet (269 KB) SDS (252 KB)

COA (241 KB) RP-HPLC (113 KB) MS (211 KB) Elemental Analysis Report (101 KB)

Handling Instructions (2659 KB)

References

[1]. Jiao S, et al. A peptide mimicking VGLL4 function acts as a YAP antagonist therapy against gastric cancer. Cancer Cell. 2014 Feb 10;25(2):166-80. [Content Brief]

[2]. Qian Chen, et al. ACTN1 supports tumor growth by inhibiting Hippo signaling in hepatocellular carcinoma. J Exp Clin Cancer Res. 2021 Jan 7;40(1):23. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2980 mL	1.4901 mL	2.9802 mL	7.4505 mL
	5 mM	0.0596 mL	0.2980 mL	0.5960 mL	1.4901 mL
	10 mM	0.0298 mL	0.1490 mL	0.2980 mL	0.7450 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Super-TDU (1-31) (TFA) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Super-TDU (1-31) (TFA)YAPYes-associated proteinYAP-TEADgastric cancerACTN1Huh-7LM3 cellInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks