2. Stem Cell/Wnt
  3. YAP
  4. Super-TDU TFA

Super-TDU TFA is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU TFA suppresses tumor growth in gastric cancer mouse model.

For research use only. We do not sell to patients.

Super-TDU TFA Chemical Structure

Super-TDU TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Super-TDU TFA:

Other Forms of Super-TDU TFA:

Super-TDU TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Super-TDU TFA is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU TFA suppresses tumor growth in gastric cancer mouse model[1].

In Vitro

Super-TDU TFA downregulates expression of YAP-TEADs target genes CTGF, CYR61, and CDX2. Super-TDU TFA inhibits cell viability and colony formation of GC cell lines MGC-803, BGC-823, and HGC27[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Super-TDU TFA Related Antibodies
In Vivo

Super-TDU TFA (intravenous Injection; 50 μg/kg or 500 μg/kg; per day) markedly decreases the sizes, weights of tumors, and YAP target genes in a dose-dependent manner in mice[1].
Super-TDU TFA (Intravenous Injection; 250 μg/kg 500 μg/kg) has the t1/2α of 0.78 hours and 0.82 hours; the Cmax of 6.12 ng/mL and 13.3 ng/mL; the CL of 7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: BALB/cA nu/nu mice[1]
Dosage: 50 μg/kg or 500 μg/kg
Administration: Intravenous Injection; per day
Result: Decreased the sizes, weights of tumors, and YAP target genes in a dose-dependent manner.
Animal Model: BALB/cA nu/nu mice[1]
Dosage: 250 μg/kg or 500 μg/kg (Pharmacokinetic Study)
Administration: Intravenous Injection
Result: The t1/2α is 0.78 hours and 0.82 hours; the Cmax is 6.12 ng/mL and 13.3 ng/mL; the CL is7.41 ml/min/kg and 7.72 ml/min/kg for 250 μg/kg and 500 μg/kg in mice, respectively.
Molecular Weight

5280.92 (free acid)

Formula

C237H369N65O70S.xC2HF3O2
Sequence Shortening

SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE
SMILES

O=C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H](C)C(N[C@@H](CCCCN)C(N[C@@H](CO)C(N[C@@H](CC(C)C)C(NCC(N[C@@H](CC(O)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@@H](C)CC)C(NCC(NCC(N[C@@H](CO)C(NCC(N[C@@H](CC(N)=O)C(N5[C@@H](CCC5)C(N[C@@H](CCCCN)C(N[C@@H]([C@H](O)C)C(N[C@@H](C)C(N[C@@H](CC(N)=O)C(N[C@@H](C(C)C)C(N6[C@@H](CCC6)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](C(C)C)C(N7[C@@H](CCC7)C(N[C@@H](CCSC)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N8[C@@H](CCC8)C(N[C@@H](CC(O)=O)C(N[C@@H](CO)C(N[C@@H](CC9=CC=CC=C9)C(N[C@@H](CC%10=CC=CC=C%10)C(N[C@@H](CCCCN)C(N%11[C@@H](CCC%11)C(N%12[C@@H](CCC%12)C(N[C@@H](CCC(O)=O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CO)N.O=C(O)C(F)(F)F
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Super-TDU TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Super-TDUYAPYes-associated proteinYAP-TEADsgastriccancerCTGFCYR61CDX2MGC-803BGC-823HGC27Inhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Super-TDU TFA
Cat. No.:
HY-P1727A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.