1. Metabolic Enzyme/Protease
  2. Elastase
  3. Tiprelestat

Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Tiprelestat Chemical Structure

Tiprelestat Chemical Structure

CAS No. : 820211-82-3

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease[1].

In Vitro

Tiprelestat (4 and 8 μM) inhibits P. aeruginosa-secreted peptidase[3].
Tiprelestat (10 μg/mL, 1 h) inhibits LPS-induced MCP-1 production in U937 cells[4].
Tiprelestat (10 μg/mL, 1 h) down-regulates LPS-induced AP-1 and NF-κB activation in U937 cells[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[4]

Cell Line: U937 cells
Concentration: 10 μg/mL
Incubation Time: 1 h
Result: Prevented LPS-induced degradation of IκBα, IκBβ, and IRAK.
In Vivo

Tiprelestat (1 mg/kg, intranasal inhalation) suppresses lung elastase activity and apoptosis in MV-O2 mice[2].
Tiprelestat (0.2 mg/kg, s.c. for 2 weeks) attenuates hypoxic pulmonary hypertension in mice[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Mice, treated with Mechanical ventilation with O2-rich gas[2]
Dosage: 1 mg/kg
Administration: Intranasal inhalation
Result: Increased the lung abundance of nuclear Klf4 protein.
Animal Model: Su/Hx rat model[5]
Dosage: 0.2 mg/kg
Administration: Subcutaneous injection (s.c.), daily for 2 weeks.
Result: Reduced elastase activity and reversed pulmonary hypertension.
Clinical Trial
Molecular Weight

5999.09

Formula

C254H416N72O75S10

CAS No.
Sequence

Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln (Disulfide bridge: Cys16-Cys45, Cys23-Cys49, Cys32-Cys44, Cys38-Cys53)

Sequence Shortening

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disulfide bridge: Cys16-Cys45, Cys23-Cys49, Cys32-Cys44, Cys38-Cys53)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tiprelestat
Cat. No.:
HY-106216
Quantity:
MCE Japan Authorized Agent: