1. Membrane Transporter/Ion Channel
  2. CFTR
  3. Urocortin III (mouse) (free acid)

Urocortin III (mouse) (free acid) is a selective CRF2 receptor agonist (with high affinity for the CRF2 receptor). Urocortin III (mouse) (free acid) significantly inhibits gastric emptying without modifying colonic transit.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urocortin III (mouse) (free acid) Chemical Structure

Urocortin III (mouse) (free acid) Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Urocortin III (mouse) (free acid) is a selective CRF2 receptor agonist (with high affinity for the CRF2 receptor). Urocortin III (mouse) (free acid) significantly inhibits gastric emptying without modifying colonic transit[1][2].

IC50 & Target

CRF2 receptor[1][2].

In Vivo

Urocortin III (mouse) (free acid) (120 µg/kg; i.p.; single) inhibits gastric emptying of a solid meal without modifying colonic transit in mice[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Adult male C57BL/6 mice (6 to 8-week-old)[1].
Dosage: 12, 60, 120 µg/kg
Administration: Intraperitoneal injection; single
Result: Inhibited gastric emptying of the solid meal only at the highest dose, and did not alter distal colonic transit.
Molecular Weight

4171.26

Formula

C186H311N51S2

Sequence Shortening

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Urocortin III (mouse) (free acid)
Cat. No.:
HY-P3597
Quantity:
MCE Japan Authorized Agent: