1. Membrane Transporter/Ion Channel Neuronal Signaling
  2. nAChR
  3. α-Bungarotoxin, FITC labeled

α-Bungarotoxin, FITC labeled 

Cat. No.: HY-P1264F Purity: ≥95.0%
SDS COA Handling Instructions

α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

α-Bungarotoxin, FITC labeled Chemical Structure

α-Bungarotoxin, FITC labeled Chemical Structure

Size Price Stock Quantity
50 μg In-stock
100 μg In-stock

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of α-Bungarotoxin, FITC labeled:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs)[1].

Molecular Weight

8500 (approximately)

Appearance

Solid

Color

Yellow to orange

Sequence

Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65),FITC labeled

Sequence Shortening

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65),FITC labeled

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation

Purity: ≥95.0%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
α-Bungarotoxin, FITC labeled
Cat. No.:
HY-P1264F
Quantity:
MCE Japan Authorized Agent: