ω-Grammotoxin SIA (Synonyms: GrTx; ω-GsTx SIA)

Cat. No.: HY-P2699: FAQs
Data Sheet Handling Instructions

Molarity Calculator

ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

ω-Grammotoxin SIA Chemical Structure

CAS No. : 152617-90-8

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Calcium Channel Isoform Specific Products:

View All Isoforms

N-type calcium channel L-type calcium channel P/Q-type calcium channel T-type calcium channel Calcium Channel

Biological Activity
Purity & Documentation
References
Customer Review

Description	ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases^[1].
Molecular Weight	4109.70
Formula	C₁₇₇H₂₆₃N₅₃O₄₉S₆
CAS No.	152617-90-8
Sequence	Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys30)
Sequence Shortening	DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys30)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (260 KB) Handling Instructions (2659 KB)
References	[1]. Takeuchi K, et al. Solution structure of omega-grammotoxin SIA, a gating modifier of P/Q and N-type Ca(2+) channel. J Mol Biol. 2002 Aug 16;321(3):517-26. [Content Brief]

ω-Grammotoxin SIA Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

ω-Grammotoxin SIA152617-90-8GrTx ω-GsTx SIACalcium ChannelCa2+ channelsCa channelsspidervenomneurological diseasescardiovascular diseasesInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

ω-Grammotoxin SIA (Synonyms: GrTx; ω-GsTx SIA)

ω-Grammotoxin SIA Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Calcium Channel Isoform Specific Products:

Biological Activity

Purity & Documentation

References

Customer Review