5-FAM-Ahx-LL-37 TFA 

5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity^[1].

4964.72 (free acid)

C₂₃₂H₃₆₁N₆₁O₆₀.xC₂HF₃O₂

Solid

{5-FAM-Ahx}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

{5-FAM-Ahx}[LL-37, 37 aa]

OC[C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H]1N(CCC1)C([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC(CCCCCNC(C2=CC3=C(C=C2)C4(OC3=O)C5=C(C=C(C=C5)O)OC6=C4C=CC(O)=C6)=O)=O)CC(C)C)=O)CC(C)C)=O)=O)CC(O)=O)=O)CC7=CC=CC=C7)=O)CC8=CC=CC=C8)=O)CCCNC(N)=N)=O)CCCCN)=O)CO)=O)CCCCN)=O)CCC(O)=O)=O)CCCCN)=O)[C@H](CC)C)=O)=O)CCCCN)=O)CCC(O)=O)=O)CC9=CC=CC=C9)=O)CCCCN)=O)CCCNC(N)=N)=O)[C@H](CC)C)=O)C(C)C)=O)CCC(N)=O)=O)CCCNC(N)=N)=O)[C@H](CC)C)=O)CCCCN)=O)CC(O)=O)=O)CC%10=CC=CC=C%10)=O)CC(C)C)=O)CCCNC(N)=N)=O)CC(N)=O)=O)CC(C)C)=O)C(C)C)=O)=O)CCCNC(N)=N)=O)[C@@H](C)O)=O)CCC(O)=O)=O)C(O)=O.OC(C(F)(F)F)=O.[x]

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)