1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. Adrenomedullin (AM) (22-52), human

Adrenomedullin (AM) (22-52), human  (Synonyms: 22-52-Adrenomedullin (human))

Cat. No.: HY-P1471 Purity: 99.61%
SDS COA Handling Instructions Technical Support

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenomedullin (AM) (22-52), human Chemical Structure

Adrenomedullin (AM) (22-52), human Chemical Structure

CAS No. : 159899-65-7

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenomedullin (AM) (22-52), human:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Adrenomedullin (AM) (22-52), human

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2].

IC50 & Target

Adrenomedullin receptor, CGRP receptor[1]

In Vitro

Adrenomedullin (AM) (22-52), human shows no effect on hindlimb perfusion pressure responses to adrenomedullin (ADM) at 120 nmol. However, Adrenomedullin (AM) (22-52), human selectively and reversibly decreases vasodilator responses to human calcitonin generelated peptide (hCGRP) at 30 nmol, with similar effect to that of CGRP antagonist[1].
Adrenomedullin (AM) (22-52), human competitively inhibits the binding of the Adrenomedullin in a dose-dependent manner, inhibits Adrenomedullin -induced cAMP accumulation in rat vascular smooth muscle cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3575.98

Formula

C159H252N46O48

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

Sequence Shortening

TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (27.96 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 50 mg/mL (13.98 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2796 mL 1.3982 mL 2.7964 mL
5 mM 0.0559 mL 0.2796 mL 0.5593 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.61%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.2796 mL 1.3982 mL 2.7964 mL 6.9911 mL
5 mM 0.0559 mL 0.2796 mL 0.5593 mL 1.3982 mL
10 mM 0.0280 mL 0.1398 mL 0.2796 mL 0.6991 mL
DMSO 15 mM 0.0186 mL 0.0932 mL 0.1864 mL 0.4661 mL
20 mM 0.0140 mL 0.0699 mL 0.1398 mL 0.3496 mL
25 mM 0.0112 mL 0.0559 mL 0.1119 mL 0.2796 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin (AM) (22-52), human
Cat. No.:
HY-P1471
Quantity:
MCE Japan Authorized Agent: