CRF, bovine (Synonyms: Corticotropin Releasing Factor bovine)

Cat. No.: HY-P1533: FAQs
Data Sheet Handling Instructions

Molarity Calculator

CRF, bovine is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CRF, bovine Chemical Structure

CAS No. : 92307-52-3

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of CRF, bovine:

CRF, bovine TFA

Other Forms of CRF, bovine:

CRF, bovine TFA In-stock

1 Publications Citing Use of MCE CRF, bovine

•Sci Adv. 2024 May 10;10(19):eadk7636. [Abstract]

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All CRFR Isoform Specific Products:

View All Isoforms

CRFR1 CRFR2

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description	CRF, bovine is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM.
IC₅₀ & Target	Ki: 3.52 nM (CRF receptor)^[1]
In Vitro	CRF, bovine is a potent agonist of CRF receptor, and displaces [¹²⁵I-Tyr]ovine CRF with a K_i of 3.52 nM^[1]. CRF shows pEC₅₀s of 11.16, 8.53 and 8.70 for human CRF₁, human CRF₂ and rat CRF_2α^[2]. CRF is released from hypothalamic-pituitary-adrenal (HPA) axis induced by stress, and leads to production of glucocorticoids which down regulate immune responses. CRF also has proinflammatory effects. CRF affects brain microvessel endothelial cells (BMEC) structure or function, CRF (100 nM) significantly increases cAMP in BMEC^[3]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. CRF, bovine Related Antibodies
Molecular Weight	4697.34
Formula	C₂₀₆H₃₄₀N₆₀O₆₃S
CAS No.	92307-52-3
Sequence	Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Sequence Shortening	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (264 KB) Handling Instructions (2659 KB)
References	[1]. Hogg JE, et al. The human neuroblastoma cell line, IMR-32, expresses functional corticotropin-releasing factor receptors. Eur J Pharmacol. 1996 Sep 26;312(2):257-61. [Content Brief] [2]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. [Content Brief] [3]. Esposito P, et al. Corticotropin-releasing factor (CRF) can directly affect brain microvessel endothelial cells. Brain Res. 2003 Apr 11;968(2):192-8. [Content Brief]

Cell Assay
^[3]

CRF (1 μM) is added to the cell cultures that are further incubated for 5, 15 and 30 min at 37°C. Control cells are incubated with medium only. Following incubation time, cells are lysed directly on the growth dish using the detergent provided by the cAMP enzyme immunoassay kit. Following trypan blue staining to ensure complete lysis, the cell lysate is collected and assayed for cAMP. In some cases, the brain microvessel endothelial cells (BMEC) are treated with forskolin or pretreated either with the CRFR antagonist Antalarmin (1 μM) or the ATP analogue 2′5′-deoxyadenosine for 5 min at 37°C^[3].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

[1]. Hogg JE, et al. The human neuroblastoma cell line, IMR-32, expresses functional corticotropin-releasing factor receptors. Eur J Pharmacol. 1996 Sep 26;312(2):257-61. [Content Brief]

[2]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. [Content Brief]

[3]. Esposito P, et al. Corticotropin-releasing factor (CRF) can directly affect brain microvessel endothelial cells. Brain Res. 2003 Apr 11;968(2):192-8. [Content Brief]

CRF, bovine Related Classifications

Inflammation/Immunology Endocrinology

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

CRF, bovine92307-52-3Corticotropin Releasing Factor bovineCRFRCorticotropin-releasing Factor ReceptorCRHRInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #