1. Metabolic Enzyme/Protease Anti-infection
  2. Cytochrome P450 Bacterial Antibiotic
  3. Cecropin B

Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Cecropin B Chemical Structure

Cecropin B Chemical Structure

CAS No. : 80451-05-4

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 2 publication(s) in Google Scholar

Other Forms of Cecropin B:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Cecropin B

RT-PCR

    Cecropin B purchased from MedChemExpress. Usage Cited in: PeerJ. 2018 Jul 25;6:e5369.  [Abstract]

    Effects of Cecropin B and Cecropin DH on mRNA levels of inflammatory cytokines in 200 ng/mL LPS-stimulated RAW264.7 cells. Total RNA is analyzed for the expression of TNF-α, IL-1β, iNOS, MIP-1, MIP-2, IL-6 and GAPDH (loading control) by RT-PCR.
    • Biological Activity

    • Protocol

    • Purity & Documentation

    • References

    • Customer Review

    Description

    Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.

    IC50 & Target

    CYP3

     

    In Vitro

    Cecropin B-induces NF-κB activation playing a pivotal role in the suppression of CYP3A29 through disrupting the association of the PXR/retinoid X receptor alpha (RXR-α) complex with DNA sequences. Cecropin B activates pig liver cells by interacting with TLRs 2 and 4, which modulated NF-κB-mediated signaling pathways[1].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    In Vivo

    The wounds are moist with more exudation in C group, while that in other groups are dry without obvious exudation. The body temperature of the majority of the mice in each group is elevated, but the number of leucocytes in each group is lowered after operation. The quantity of bacteria in muscle in A group is obviously lower than that in M group and C group. The number of surviving mice after 4 PID in C group is evidently smaller than that in A and M groups( P<0. 05)[2].

    MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

    Molecular Weight

    3834.67

    Formula

    C176H302N52O41S

    CAS No.
    Appearance

    Solid

    Color

    White to off-white

    Sequence

    Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2

    Sequence Shortening

    KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Storage

    Sealed storage, away from moisture

    Powder -80°C 2 years
    -20°C 1 year

    *In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

    Solvent & Solubility
    In Vitro: 

    H2O : 66.67 mg/mL (17.39 mM; Need ultrasonic)

    Preparing
    Stock Solutions
    Concentration Solvent Mass 1 mg 5 mg 10 mg
    1 mM 0.2608 mL 1.3039 mL 2.6078 mL
    5 mM 0.0522 mL 0.2608 mL 0.5216 mL
    View the Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • Molarity Calculator

    • Dilution Calculator

    Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

    Mass
    =
    Concentration
    ×
    Volume
    ×
    Molecular Weight *

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start)

    C1

    ×
    Volume (start)

    V1

    =
    Concentration (final)

    C2

    ×
    Volume (final)

    V2

    In Vivo:

    For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
    The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

    • Protocol 1

      Add each solvent one by one:  PBS

      Solubility: 50 mg/mL (13.04 mM); Clear solution; Need ultrasonic

    In Vivo Dissolution Calculator
    Please enter the basic information of animal experiments:

    Dosage

    mg/kg

    Animal weight
    (per animal)

    g

    Dosing volume
    (per animal)

    μL

    Number of animals

    Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
    Calculation results:
    Working solution concentration: mg/mL
    This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
    The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
    Purity & Documentation
    References
    Animal Administration
    [1]

    Mice[1]
    Thirty ICR mice are enrolled in the study, and the Pseudomonas aeruginosa infection model is reproduced by excision of the full layer of dorsal skin with an area of 1 cm x 1 cm. Then they are randomly divided into C (control, n=10, with wet compress of isotonic saline at 3 postinjury hour (PIH)) , M (with hydropathic compress of 100 g/L mafenide at 3 PIH), A (with wet compress of 1 000 mg/L Cecropin B at 3 PIH) groups. The changes in body temperature and hemogram in each group are determined before and 4 days after injury[2].

    MCE has not independently confirmed the accuracy of these methods. They are for reference only.

    References

    Complete Stock Solution Preparation Table

    * Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
    Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

    Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
    H2O 1 mM 0.2608 mL 1.3039 mL 2.6078 mL 6.5195 mL
    5 mM 0.0522 mL 0.2608 mL 0.5216 mL 1.3039 mL
    10 mM 0.0261 mL 0.1304 mL 0.2608 mL 0.6519 mL
    15 mM 0.0174 mL 0.0869 mL 0.1739 mL 0.4346 mL

    * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

    • No file chosen (Maximum size is: 1024 Kb)
    • If you have published this work, please enter the PubMed ID.
    • Your name will appear on the site.
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Product Name

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Cecropin B
    Cat. No.:
    HY-P0092
    Quantity:
    MCE Japan Authorized Agent: