1. GPCR/G Protein
  2. PACAP Receptor
  3. PACAP (1-27), human, ovine, rat

PACAP (1-27), human, ovine, rat  (Synonyms: PACAP 1-27)

Cat. No.: HY-P0176 Purity: 99.79%
Handling Instructions Technical Support

PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PACAP (1-27), human, ovine, rat Chemical Structure

PACAP (1-27), human, ovine, rat Chemical Structure

CAS No. : 127317-03-7

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 2 publication(s) in Google Scholar

Other Forms of PACAP (1-27), human, ovine, rat:

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively[1].

IC50 & Target

IC50: 3 nM (rat PAC1), 2 nM (rat VPAC1), 5 nM (human VPAC2)[1]

In Vitro

Radioligand receptor binding assays with I-monoiodinated PACAP (1-27), human, ovine, rat confirms the presence of PAC -receptors on AR4-2J cells, since PACAP (1-27), human, ovine, rat and PACAP(1–38) equipotently displaces radioligand binding with a Kd of 1-2 nM, whereas vasoactive intestinal peptide (VIP) is 1000-fold less potent. PACAP (1-27), human, ovine, rat exhibits a distinct and much higher susceptibility to VIP-amino acid substitutions. PACAP (1-27), human, ovine, rat has potency and binding affinity to stimulate IP3 and cAMP formation in AR4-2J cells[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

The inhibitory effect of pituitary adenylate cyclase activating polypeptide (PACAP (1-27), human, ovine, rat) on the increase in total pulmonary resistance (RL) causes either by allergen or histamine in anaesthetized, ventilated guinea-pigs is studied. PACAP (1-27), human, ovine, rat given via i.v. infusion (0.045-4.5 nmol/kg/min) dose-dependently reduces the increase in RL caused by inhaled ovalbumin and histamine. At the highest dose, PACAP (1-27), human, ovine, rat prevented the increase in RL caused by ovalbumin and histamine completely. Infusion of PACAP (1-27), human, ovine, rat and the β2-adrenoceptor agonist, salbutamol (0.045-4.5 nmol/kg/min) inhibit the increase in RL similarly, but salbutamol increases the heart rate more than PACAP (1-27), human, ovine, rat[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3147.66

Formula

C142H224N40O39S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2

Sequence Shortening

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (31.77 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3177 mL 1.5885 mL 3.1770 mL
5 mM 0.0635 mL 0.3177 mL 0.6354 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.79%

References
Animal Administration
[3][4]

Guinea-pigs[3]

PACAP-27 (0.045 to 4.5 nmol/kg/min), salbutamol (0.045 to 4.5 nmol/kg/min) or sterile saline is given i.v. (1.0 mL) via an infusion pump, starting 5 min before and continuing 10 min after airway challenge[3].

Dogs[4]

Four dogs (28.4±1.8 kg) receive PACAP (1-27) with four different concentrations of 0.01, 0.1, 1.0 and 10 µg/mL, or 0.00318, 0.0318, 0.318 and 3.18 µM, respectively. Each solution is locally infused at a rate of 0.5 mL/min for precisely 1 min. A total dose delivered to the pancreas during each infusion is therefore 0.005, 0.05, 0.5 and 5 µg. The dead volume of the pancreatic arterial catheter (0.5 mL) is taken into account in relation to the infusion rate. After taking the initial control sample, simultaneously from the SPD vein and the aorta, saline is infused for 1 min and samples are obtained 1, 3 and 5 min after the onset of infusion. This procedure is repeated every 15 min for the doses of PACAP (1-27). The sample obtained at 15 min after the onset of each infusion served as control for the subsequent intervention[4].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.3177 mL 1.5885 mL 3.1770 mL 7.9424 mL
5 mM 0.0635 mL 0.3177 mL 0.6354 mL 1.5885 mL
10 mM 0.0318 mL 0.1588 mL 0.3177 mL 0.7942 mL
15 mM 0.0212 mL 0.1059 mL 0.2118 mL 0.5295 mL
20 mM 0.0159 mL 0.0794 mL 0.1588 mL 0.3971 mL
25 mM 0.0127 mL 0.0635 mL 0.1271 mL 0.3177 mL
30 mM 0.0106 mL 0.0529 mL 0.1059 mL 0.2647 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PACAP (1-27), human, ovine, rat
Cat. No.:
HY-P0176
Quantity:
MCE Japan Authorized Agent: