Urotensin I  (Synonyms: Catostomus urotensin I)

Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC₅₀s of 11.46, 9.36 and 9.85 for human CRF₁, human CRF₂ and rat CRF_2α receptors in CHO cells, and K_is of 0.4, 1.8, and 5.7 nM for hCRF₁, rCRF_2α and mCRF_2β receptors, respectively^[1][2].

pEC50: 11.46 (human CRF₁, CHO cells), 9.36 (human CRF₂, CHO cells), 9.85 (rat CRF_2α, CHO cells)^[1]
Ki: 0.4 nM (hCRF₁, cell assay), 1.8 nM (rCRF_2α, cell assay), and 5.7 nM (mCRF_2β, cell assay)^[2]

Urotensin I is 2-3 times more potent than CRF or sauvagine in stimulating ACTH release from a superfused goldfish anterior pituitary cell column^[3].
Rat tail artery strips were incubated in the presence of 4 x 10(-3) M theophylline and Urotensin I (UI). At the concentrations of 1.50, 7.50 mU/ml but not of 0.75 mU/ml Urotensin I, the content of cAMP increased significantly^[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Intraperitoneal injections of urotensin I, a CRF-like neuropeptide isolated from the caudal neurosecretory system of the teleost Catostomus commersoni, ovine CRF and sauvagine all produced significant increases in circulating levels of plasma cortisol in goldfish in which endogenous ACTH secretion was suppressed with betamethasone^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4869.46

C₂₁₀H₃₄₀N₆₂O₆₇S₂

83930-33-0

Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2

NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Smart D, et al. Characterisation using microphysiometry of CRF receptor pharmacology. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35.  [Content Brief]

  [2]. Reul JM, et al. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Curr Opin Pharmacol. 2002 Feb;2(1):23-33.  [Content Brief]

  [3]. Fryer J, et al. Urotensin I, a CRF-like neuropeptide, stimulates acth release from the teleost pituitary. Endocrinology. 1983;113(6):2308-2310.  [Content Brief]

  [4]. Gerritsen ME, et al. Urotensin I effects on intracellular content of cyclic AMP in the rat tail artery. Eur J Pharmacol. 1979;60(2-3):211-220.  [Content Brief]