β-Endorphin, human 

β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.

β-Endorphin, human is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor. β-Endorphin exhibits anti-nociception activity by stimulating ε-opioid receptor, rather than μ-, δ-, and κ-opioid receptor^[1]. β-Endorphin has anti-nociception activity. Firstly, β-Endorphin combines together with the opioid receptors in hyperalgesia. Further, β-Endorphin suppresses the release of substance P at the level of spinal cord and blocks the conduction of pain on the primary sensory neurons. Moreover, β-Endorphin activates the endogenous analgesia system located in the CNS. In addition, β-Endorphin inhibits the conduction of pain and agitation of nociceptors to exert an analgesic effect^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3464.98

C₁₅₈H₂₅₁N₃₉O₄₆S

61214-51-5

Solid

White to off-white

Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

• [1]. Narita M, et al. Evidence for the existence of the beta-endorphin-sensitive "epsilon-opioid receptor" in the brain: the mechanisms of epsilon-mediated antinociception. Jpn J Pharmacol. 1998 Mar;76(3):233-53.  [Content Brief]

  [2]. Luan YH, et al. Action of β-endorphin and nonsteroidal anti-inflammatory drugs, and the possible effects of nonsteroidal anti-inflammatory drugs on β-endorphin. J Clin Anesth. 2017 Feb;37:123-128.  [Content Brief]