APTSTAT3-9R 

APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity^[1].

APTSTAT3-9R (7.5, 15, and 30 μmol/L; 6 hours) significantly reduces STAT3–DNA-binding activity in a dose-dependent manner in human lung carcinoma cells (A549)^[1].
APTSTAT3-9R (30 μM; for 2 weeks) suppresses cell viability and proliferation of cancer cells and significantly suppresses colony formation. APTSTAT3-9R has IC50s of 10 to 20 μM in A549, B16F1 and HepG2 cells^[1].
APTSTAT3-9R (7.5, 15, and 30 μmol/L; 6 hours) effectively inhibits phosphorylation of STAT3 but does not affect the level of AKT phosphorylation, indicating specificity of the aptide^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

APTSTAT3-9R (8 mg/kg in 50 μL; intratumorally injected every other day for a total of four injections) suppresses tumor growth in 6-week-old female BALB/c nude mice with A549 cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4947.51

C_223H330N₈₀O₅₁

Solid

White to off-white

His-Gly-Phe-Gln-Trp-Pro-Gly-Ser-Trp-Thr-Trp-Glu-Asn-Gly-Lys-Trp-Thr-Trp-Lys-Gly-Ala-Tyr-Gln-Phe-Leu-Lys-Gly-Gly-Gly-Gly-Ser-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg

HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light, under nitrogen

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

• [1]. Daejin Kim, et al. A Specific STAT3-binding Peptide Exerts Antiproliferative Effects and Antitumor Activity by Inhibiting STAT3 Phosphorylation and Signaling. Cancer Res. 2014 Apr 15;74(8):2144-51.  [Content Brief]