BMAP-28

Cat. No.: HY-P5288: FAQs
Data Sheet Handling Instructions

Molarity Calculator

BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer.

For research use only. We do not sell to patients.

BMAP-28 Chemical Structure

CAS No. : 184870-31-3

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Antibiotic Isoform Specific Products:

View All Isoforms

Aminoglycoside Glycopeptide Lipopeptide Macrolide Oxazolidinone Quinolone Tetracycline β-lactam

Biological Activity
Purity & Documentation
References
Customer Review

Description

In Vitro

BMAP-28 (3 µM; 10 min) attenuates mitochondrial calcein fluorescence in U937 cells^[1].
BMAP-28 causes depolarization of the inner mitochondrial membrane in single cells and in isolated mitochondria^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Immunofluorescence^[1]

Cell Line:	U937 cells
Concentration:	3 µM
Incubation Time:	10 min
Result:	Caused a remarkable attenuation of the calcein fluorescence.

Molecular Weight

3073.81

Formula

C₁₄₅H₂₅₀N₄₄O₂₉

CAS No.

184870-31-3

Sequence

Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2

Sequence Shortening

GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Risso A, et al. BMAP-28, an antibiotic peptide of innate immunity, induces cell death through opening of the mitochondrial permeability transition pore. Mol Cell Biol. 2002 Mar;22(6):1926-35. [Content Brief]

BMAP-28 Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

BMAP-28184870-31-3BMAP28BMAP 28AntibioticU937 cellsmitochondriacancerinfectionpeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks