1. JAK/STAT Signaling Protein Tyrosine Kinase/RTK Metabolic Enzyme/Protease Membrane Transporter/Ion Channel Neuronal Signaling
  2. EGFR MMP Calcium Channel
  3. Candidalysin

Candidalysin is a cytolytic peptide toxin, which is initially isolated from Candida albicans and exhibits virulent and avirulent characters. Candidalysin activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) of host cells, activates matrix metalloproteinase (MMP) and calcium flux, resulting in inflammatory responses and recruitment of immune cells. Candidalysin exhibits cytotoxicity by dealing membran damage to host cells.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Candidalysin Chemical Structure

Candidalysin Chemical Structure

CAS No. : 1906866-53-2

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Candidalysin is a cytolytic peptide toxin, which is initially isolated from Candida albicans and exhibits virulent and avirulent characters. Candidalysin activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) of host cells, activates matrix metalloproteinase (MMP) and calcium flux, resulting in inflammatory responses and recruitment of immune cells. Candidalysin exhibits cytotoxicity by dealing membran damage to host cells[1].

Molecular Weight

3310.11

Formula

C153H266N38O38S2

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Ile-Ile-Gly-Ile-Ile-Met-Gly-Ile-Leu-Gly-Asn-Ile-Pro-Gln-Val-Ile-Gln-Ile-Ile-Met-Ser-Ile-Val-Lys-Ala-Phe-Lys-Gly-Asn-Lys

Sequence Shortening

SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 25 mg/mL (7.55 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H2O : 25 mg/mL (7.55 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3021 mL 1.5105 mL 3.0210 mL
5 mM 0.0604 mL 0.3021 mL 0.6042 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.38%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.3021 mL 1.5105 mL 3.0210 mL 7.5526 mL
5 mM 0.0604 mL 0.3021 mL 0.6042 mL 1.5105 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Candidalysin
Cat. No.:
HY-P10408
Quantity:
MCE Japan Authorized Agent: