1. GPCR/G Protein
  2. Angiotensin Receptor
  3. CNP-38

CNP-38 is a C-type natriuretic peptide.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CNP-38 Chemical Structure

CNP-38 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Angiotensin Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

CNP-38 is a C-type natriuretic peptide[1].

In Vivo

CNP-38 (s.c., 800 µg/kg, once) reduces blood pressure in male telemetered adult Crl:CD1(ICR) mice[1].
CNP-38 (subcutaneous injections or continuous infusion, 203 µg/kg, daily for 5 weeks) makes the axis and limb bones of mice grow significantly, and the effect of continuous infusion was more obvious[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male FVB mice
Dosage: 203 µg/kg
Administration: Subcutaneous injections or continuous infusion, daily for 5 weeks
Result: Resulted in increases of 7.1% in femoral length, 12.2% in tibia length and 25% in spinal length by continuous infusion, while daily subcutaneous administration induced increases of 5.5%, 4% and 11.3%, respectively.
Molecular Weight

4061.72

Formula

C175H291N55O50S3

Sequence

Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys22-Cys38)

Sequence Shortening

LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: Cys22-Cys38)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNP-38
Cat. No.:
HY-P5127
Quantity:
MCE Japan Authorized Agent: