CNP-38

Cat. No.: HY-P5127: FAQs
Data Sheet Handling Instructions

Molarity Calculator

CNP-38 is a C-type natriuretic peptide.

For research use only. We do not sell to patients.

CNP-38 Chemical Structure

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Angiotensin Receptor Isoform Specific Products:

View All Isoforms

AT1 Receptor AT2 Receptor

Biological Activity
Purity & Documentation
References
Customer Review

Description

CNP-38 is a C-type natriuretic peptide^[1].

In Vivo

CNP-38 (s.c., 800 µg/kg, once) reduces blood pressure in male telemetered adult Crl:CD1(ICR) mice^[1].
CNP-38 (subcutaneous injections or continuous infusion, 203 µg/kg, daily for 5 weeks) makes the axis and limb bones of mice grow significantly, and the effect of continuous infusion was more obvious^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Male FVB mice
Dosage:	203 µg/kg
Administration:	Subcutaneous injections or continuous infusion, daily for 5 weeks
Result:	Resulted in increases of 7.1% in femoral length, 12.2% in tibia length and 25% in spinal length by continuous infusion, while daily subcutaneous administration induced increases of 5.5%, 4% and 11.3%, respectively.

Molecular Weight

4061.72

Formula

C₁₇₅H₂₉₁N₅₅O₅₀S₃

Sequence

Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys22-Cys38)

Sequence Shortening

LQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: Cys22-Cys38)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Vibeke Miller Breinholt, et al. TransCon CNP, a Sustained-Release C-Type Natriuretic Peptide Prodrug, a Potentially Safe and Efficacious New Therapeutic Modality for the Treatment of Comorbidities Associated with Fibroblast Growth Factor Receptor 3-Related Skeletal Dysplasias. J Pharmacol Exp Ther. 2019 Sep;370(3):459-471. [Content Brief]

CNP-38 Related Classifications

Cardiovascular Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

CNP-38CNP38CNP 38Angiotensin ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks