2. Membrane Transporter/Ion Channel
  3. Potassium Channel
  4. Dendrotoxin-I TFA

Dendrotoxin-I (DTX-I) TFA is a potent K+ channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research.

For research use only. We do not sell to patients.

Dendrotoxin-I TFA Chemical Structure

Dendrotoxin-I TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Dendrotoxin-I TFA:

Dendrotoxin-I TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Dendrotoxin-I (DTX-I) TFA is a potent K+ channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research[1][2][3].

IC50 & Target[1]

Kv1.1

0.13-50 nM (IC50)

Kv1.2

0.13-50 nM (IC50)

Kv1.6

0.13-50 nM (IC50)

In Vivo

Dendrotoxin-I (5 mg/kg; IV) TFA displays a significant tumor growth inhibition effect combined with hyperthermia[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Nude mice with MCF-7 cells[3]
Dosage: 5 mg/kg
Administration: IV
Result: Displayed a significanttumor growth inhibition effect combined with hyperthermia.
Could not keep on inhibiting the growth of tumor at the later period of treatment.
Molecular Weight

7149.24 (free acid)

Formula

C312H491N99O83S6.xC2HF3O2
Sequence

Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
Sequence Shortening

QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
SMILES

O=C(N1[C@@H](CCC1)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CSSC[C@@H](C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(O)=O)=O)=O)=O)NC2=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(C)C)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(N)=O)C(N4[C@@H](CCC4)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CSSC[C@@H](C(NCC(NCC(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC5=CC=CC=C5)C(N[C@@H](CCCCN)C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(N[C@H]6CCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N7)C(N[C@@H](CC8=CC=C(C=C8)O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H]([C@@H](C)CC)C(N9[C@@H](CCC9)C(N[C@@H](C)C(N[C@@H](CC%10=CC=CC=C%10)C(N[C@@H](CC%11=CC=C(C=C%11)O)C(N[C@@H](CC%12=CC=C(C=C%12)O)C(N[C@@H](CC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCC(N)=O)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@H]2[C@H](O)C)=O)=O)=O)NC6=O)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CC%13=CC=CC=C%13)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC%14=CNC%15=CC=CC=C%14%15)C(N[C@@H](CO)C(NCC7=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCC(N)=O)N.O=C(C(F)(F)F)O.[x]
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Dendrotoxin-I TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Dendrotoxin-IDTX-IPotassium ChannelKcsAvoltage-gated potassium channelneurotoxinDendroaspis snakescancerInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Dendrotoxin-I TFA
Cat. No.:
HY-P3055A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.