1. GPCR/G Protein
  2. GHSR
  3. GHRF, bovine

GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone.html" class="link-product" target="_blank">Hydrocortisone (HY-N0583).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GHRF, bovine Chemical Structure

GHRF, bovine Chemical Structure

CAS No. : 88894-91-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All GHSR Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GHRF, bovine (bGRF(1-44)-NH2) is the bovine growth hormone (GH)-releasing factor (GHRF). GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone.html" class="link-product" target="_blank">Hydrocortisone (HY-N0583)[1][2].

In Vitro

GHRF, bovine (0.001 nM-100 nM; 6 h) increases growth hormone (GH) release from bovine anterior pituitary cells, with maximum release of 262% above control at 100 nM[1].
GHRF, bovine (0.0001 nM-100 nM; 24 h) linearly increases GH secretion and is enhanced by Hydrocortisone.html" class="link-product" target="_blank">Hydrocortisone (HY-N0583) (Cortisol, 10 ng/mL) in anterior pituitary cells cultured in media containing fetal calf serum (FCS)[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) has no influence on the mRNA abundance of the liver-type glucose transporter in the liver or kidney of postpartum bovine[2].
GHRF, bovine (12 mg/d; i.v.drip; from 118 to 181 d postpartum) also doesn’t alter the mRNA abundance of the erythrocyte-type or the intestinal-type glucose transporter in the kidney of postpartum bovine, but results individual differences in the mRNA abundance of the intestinal-type glucose transporter in liver[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5104.72

Formula

C220H366N72O66S

CAS No.
Sequence Shortening

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GHRF, bovine
Cat. No.:
HY-P3607
Quantity:
MCE Japan Authorized Agent: