1. GPCR/G Protein
  2. GCGR
  3. GLP-2(3-33)

GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-2(3-33) Chemical Structure

GLP-2(3-33) Chemical Structure

CAS No. : 275801-62-2

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of GLP-2(3-33):

Top Publications Citing Use of Products

1 Publications Citing Use of MCE GLP-2(3-33)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM)[1][2].

In Vitro

GLP-2 is secreted as a 33-amino acid peptide, but is rapidly degraded at an N-terminus site to GLP-2(3-33) in circulation, in large part, by dipeptidylpeptidase IV (DPPIV). GLP-2 (3-33) acts as a partial agonist with potential competitive antagonistic properties on the GLP-2 receptor. In the GLP-2 receptor-binding assay, the binding IC50 for GLP-2 1–33 was 3.1 nM, and it was 41 nM for GLP-2 3-33. Thus, GLP-2 3–33 had 7.5% binding affinity compared to GLP-2 1-33[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GLP-2(3-33) (60 ng; once a day i.p. for 4 weeks) increases dyslipidemia and hepatic lipid accumulation in HFD-fed mice[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male C57BL/6J (B6) mice (HFD)[2]
Dosage: 60 ng
Administration: Once a day i.p. for 4 weeks
Result: Significantly affected plasma lipids; Showed increase of triglycerides and cholesterol and reduction of HDL; Significantly increased plasma ALT and AST and intrahepatic lipid concentration.
Molecular Weight

3557.89

Formula

C156H242N40O53S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence Shortening

DGSFSDEMNTILDNLAARDFINWLIQTKITD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 33.33 mg/mL (9.37 mM; ultrasonic and adjust pH to 10 with NH3·H2O)

DMSO : 33.33 mg/mL (9.37 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2811 mL 1.4053 mL 2.8107 mL
5 mM 0.0562 mL 0.2811 mL 0.5621 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O / DMSO 1 mM 0.2811 mL 1.4053 mL 2.8107 mL 7.0266 mL
5 mM 0.0562 mL 0.2811 mL 0.5621 mL 1.4053 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-2(3-33)
Cat. No.:
HY-P2625
Quantity:
MCE Japan Authorized Agent: