M65

Cat. No.: HY-P4127: FAQs
Data Sheet Handling Instructions

Molarity Calculator

M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

M65 Chemical Structure

CAS No. : 1872440-65-7

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of M65:

M65 TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches^[1]^[2].
In Vitro	M65 (1 µM) completely blocks the cAMP accumulation stimulated by 100 nM of VIP, and partially inhibits the cAMP accumulation stimulated by 1 nM of maxadilan in rat cortical neurons^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. M65 Related Antibodies
Molecular Weight	4823.53
Formula	C₂₀₅H₃₂₆N₆₄O₆₁S₅
CAS No.	1872440-65-7
Sequence	Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
Sequence Shortening	CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKKEFKA-NH2 (Disulfide bridge:Cys1-Cys5,Cys14-Cys32)
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (259 KB) Handling Instructions (2659 KB)
References	[1]. Lerner EA, et al. Maxadilan, a PAC1 receptor agonist from sand flies. Peptides. 2007 Sep;28(9):1651-4. [Content Brief] [2]. Uchida D, et al. Maxadilan is a specific agonist and its deleted peptide (M65) is a specific antagonist for PACAP type 1 receptor. Ann N Y Acad Sci. 1998 Dec 11;865:253-8. [Content Brief]

M65 Related Classifications

Neurological Disease

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

M651872440-65-7M 65M-65Othersmaxadilandeleted peptideVIPcAMP accumulationInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *

Organization Name *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

M65

Other Forms of M65:

M65 Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review