Neuropeptide Y (human) (free acid)

Cat. No.: HY-P10290: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Neuropeptide Y (human) free acid upregulates the adhesiveness of human endothelial cells for leukocytes. Neuropeptide Y belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (human) (free acid) Chemical Structure

CAS No. : 99575-89-0

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Neuropeptide Y Receptor Isoform Specific Products:

View All Isoforms

NPY Y₁ receptor NPY Y₂ receptor NPY Y₄ receptor NPY Y₅ receptor

Biological Activity
Purity & Documentation
References
Customer Review

Description	Neuropeptide Y (human) free acid upregulates the adhesiveness of human endothelial cells for leukocytes. Neuropeptide Y belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response^[1]^[2].
In Vitro	Neuropeptide Y (human) free acid inhibits cyclic AMP accumulation in SK-N-MC cells stimulated by Isoproterenol (HY-B0468), Dopamine, Vasoactive intestinal peptide, Cholera toxin, and Forskolin (HY-15371)^[3]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Neuropeptide Y (human) (free acid) Related Antibodies
Molecular Weight	4272.67
Formula	C₁₈₉H₂₈₄N₅₄O₅₈S
CAS No.	99575-89-0
Sequence	Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
Sequence Shortening	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQ
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (259 KB) Handling Instructions (2659 KB)
References	[1]. Cajado et al. Neuropeptide Y family-degrading metallopeptidases in the Tityus serrulatus venom partially blocked by commercial antivenoms. Toxicol Sci. 2014 Dec;142(2):418-26. [Content Brief] [2]. Sung CP, et al. Neuropeptide Y upregulates the adhesiveness of human endothelial cells for leukocytes. Circ Res. 1991 Jan;68(1):314-8. [Content Brief] [3]. Gordon EA, et al. Characterization of functional neuropeptide Y receptors in a human neuroblastoma cell line. J Neurochem. 1990 Aug;55(2):506-13. [Content Brief]