1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Neuropeptide Y (human) free acid

Neuropeptide Y (human) free acid belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response. The amidation of Neuropeptide Y C-terminal tyrosine is critical for its function. Non-amidated Neuropeptide Y fails to elicit G protein signaling.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (human) free acid Chemical Structure

Neuropeptide Y (human) free acid Chemical Structure

CAS No. : 99575-89-0

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Neuropeptide Y (human) free acid belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response. The amidation of Neuropeptide Y C-terminal tyrosine is critical for its function. Non-amidated Neuropeptide Y fails to elicit G protein signaling[1][2][4].

In Vitro

Neuropeptide Y (human) free acid inhibits cyclic AMP accumulation in SK-N-MC cells stimulated by Isoproterenol (HY-B0468), Dopamine, Vasoactive intestinal peptide, Cholera toxin, and Forskolin (HY-15371)[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4272.67

Formula

C189H284N54O58S

CAS No.
Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr

Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQ

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropeptide Y (human) free acid
Cat. No.:
HY-P10290
Quantity:
MCE Japan Authorized Agent: