2. GPCR/G Protein Neuronal Signaling
  3. Neuropeptide Y Receptor
  4. Neuropeptide Y (human,rat,mouse)

Neuropeptide Y (human,rat,mouse)  (Synonyms: Neuropeptide Y (29-64), amide)

Cat. No.: HY-P0198 Purity: 99.94%
SDS COA Handling Instructions Technical Support

Neuropeptide Y (human,rat,mouse) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (human,rat,mouse) Chemical Structure

Neuropeptide Y (human,rat,mouse) Chemical Structure

CAS No. : 90880-35-6

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Neuropeptide Y (human,rat,mouse):

Neuropeptide Y (human,rat,mouse) Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Neuropeptide Y (human,rat,mouse)

View All Neuropeptide Y Receptor Isoform Specific Products:

View All Isoforms
NPY Y1 receptor NPY Y2 receptor NPY Y4 receptor NPY Y5 receptor

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Neuropeptide Y (human,rat,mouse) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

In Vitro

It is showed that Neuropeptide Y (human,rat,mouse) is able to protect cortical neurons from Aβ25-35 toxicity. 2 μM NPY abolishes the toxic effects of Aβ25-35 at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (human) pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human (TFA) Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ35-25[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Neuropeptide Y (human,rat,mouse) Related Antibodies
Molecular Weight

4271.68

Formula

C189H285N55O57S
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

H2O : ≥ 200 mg/mL (46.82 mM)

DMSO : 25 mg/mL (5.85 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2341 mL 1.1705 mL 2.3410 mL
5 mM 0.0468 mL 0.2341 mL 0.4682 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 99.94%

SDS (252 KB)

COA (240 KB) LCMS (87 KB)

Handling Instructions (2659 KB)
References
Cell Assay
[1]

Primary cortical neurons are preincubated either alone (positive control) or with three concentrations of Neuropeptide Y (human) (NPY) (0.5, 1, and 2 μM) for 24 h and then exposed to Aβ25-35 (50 μM) or Aβ35-25 (50 μM) for 48 h[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO / H2O 1 mM 0.2341 mL 1.1705 mL 2.3410 mL 5.8525 mL
5 mM 0.0468 mL 0.2341 mL 0.4682 mL 1.1705 mL
H2O 10 mM 0.0234 mL 0.1170 mL 0.2341 mL 0.5852 mL
15 mM 0.0156 mL 0.0780 mL 0.1561 mL 0.3902 mL
20 mM 0.0117 mL 0.0585 mL 0.1170 mL 0.2926 mL
25 mM 0.0094 mL 0.0468 mL 0.0936 mL 0.2341 mL
30 mM 0.0078 mL 0.0390 mL 0.0780 mL 0.1951 mL
40 mM 0.0059 mL 0.0293 mL 0.0585 mL 0.1463 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Neuropeptide Y (human,rat,mouse) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Neuropeptide Y (human,rat,mouse)90880-35-6Neuropeptide Y (29-64), amideNeuropeptide Y ReceptorNPY receptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuropeptide Y (human,rat,mouse)
Cat. No.:
HY-P0198
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.