1. Peptides
  2. Peptide and Derivatives
  3. Hormones and Neuropeptides
  4. Nocistatin(human) TFA

Nocistatin (human) TFA blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Nocistatin(human) TFA Chemical Structure

Nocistatin(human) TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Nocistatin(human) TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Nocistatin (human) TFA blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2[1].

In Vitro

Nocistatin (5.0 nmol) significantly improves the nociception (5.0 nmol)-induced impairment of learning and memory without changing motor activity or response to electric shocks[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3675.95

Formula

C149H238N42O53S3.C2HF3O2

Sequence

Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln

Sequence Shortening

MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nocistatin(human) TFA
Cat. No.:
HY-P1020A
Quantity:
MCE Japan Authorized Agent: