2. GPCR/G Protein Neuronal Signaling
  3. Neuropeptide Y Receptor
  4. Peptide YY (PYY) (3-36), Human

Peptide YY (PYY) (3-36), Human 

Cat. No.: HY-P10000 Purity: 98.57%
COA Handling Instructions

Molarity Calculator

Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (PYY) (3-36), Human Chemical Structure

Peptide YY (PYY) (3-36), Human Chemical Structure

CAS No. : 123583-37-9

Size Price Stock Quantity
1 mg USD 95 In-stock
5 mg USD 240 In-stock
10 mg USD 385 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Peptide YY (PYY) (3-36), Human Related Antibodies

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

View All Isoforms
NPY Y1 receptor NPY Y2 receptor NPY Y4 receptor NPY Y5 receptor

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion[1].

IC50 & Target

NPY Y2 receptor

 

Molecular Weight

4049.45

Formula

C180H279N53O54
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence Shortening

IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 25 mg/mL (6.17 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2469 mL 1.2347 mL 2.4695 mL
5 mM 0.0494 mL 0.2469 mL 0.4939 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2469 mL 1.2347 mL 2.4695 mL 6.1737 mL
5 mM 0.0494 mL 0.2469 mL 0.4939 mL 1.2347 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Peptide YY (PYY) (3-36), Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Peptide YY (PYY) (3-36), Human123583-37-9Neuropeptide Y ReceptorNPY receptorendogenousappetiteintestinal secretionneuropeptideInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peptide YY (PYY) (3-36), Human
Cat. No.:
HY-P10000
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.