1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. PHM-27 (human)

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

PHM-27 (human) Chemical Structure

PHM-27 (human) Chemical Structure

CAS No. : 87403-73-4

Size Price Stock Quantity
5 mg USD 320 In-stock
10 mg USD 510 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

PHM-27 (human) is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism[1][2][3].

IC50 & Target

EC50: 11 nM (human calcitonin receptor)[2]

Molecular Weight

2985.41

Formula

C135H214N34O40S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

{His}{Ala}{Asp}{Gly}{Val}{Phe}{Thr}{Ser}{Asp}{Phe}{Ser}{Lys}{Leu}{Leu}{Gly}{Gln}{Leu}{Ser}{Ala}{Lys}{Lys}{Tyr}{Leu}{Glu}{Ser}{Leu}{Met}-NH2

Sequence Shortening

HADGVFTSDFSKLLGQLSAKKYLESLM-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (33.50 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3350 mL 1.6748 mL 3.3496 mL
5 mM 0.0670 mL 0.3350 mL 0.6699 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.3350 mL 1.6748 mL 3.3496 mL 8.3741 mL
5 mM 0.0670 mL 0.3350 mL 0.6699 mL 1.6748 mL
10 mM 0.0335 mL 0.1675 mL 0.3350 mL 0.8374 mL
15 mM 0.0223 mL 0.1117 mL 0.2233 mL 0.5583 mL
20 mM 0.0167 mL 0.0837 mL 0.1675 mL 0.4187 mL
25 mM 0.0134 mL 0.0670 mL 0.1340 mL 0.3350 mL
30 mM 0.0112 mL 0.0558 mL 0.1117 mL 0.2791 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHM-27 (human)
Cat. No.:
HY-P1072
Quantity:
MCE Japan Authorized Agent: