1. GPCR/G Protein
  2. Amylin Receptor
  3. Pramlintide TFA

Pramlintide TFA is a polypeptide analogue of human amylin. Pramlintide TFA, an antidiabetic agent, is antineoplastic in colorectal cancer.

For research use only. We do not sell to patients.

Pramlintide TFA Chemical Structure

Pramlintide TFA Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Pramlintide TFA:

Other Forms of Pramlintide TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Pramlintide TFA is a polypeptide analogue of human amylin. Pramlintide TFA, an antidiabetic agent, is antineoplastic in colorectal cancer[1].

In Vitro

Pramlintide inhibits the growth of HCT-116 and HT-29 in a dose-dependent manner, with higher efficacy against the latter (IC50s of 48.67 and 9.10 μg/mL, respectively)[1].
The addition of 5, 10, and 20 μg/mL of Pramlintide to HCT-116 and HT-29 with 5-fluorouracil, Oxaliplatin, or Irinotecan induces the antiproliferative effect synergistically[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Clinical Trial
Molecular Weight

3949.39 (free base)

Formula

C171H267N51O53S2.xC2HF3O2

Sequence

Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7)

Sequence Shortening

KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)

SMILES

O=C([C@@H](N)CCCCN)N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H]1[C@@H](C)O)=O)C)=O)[C@@H](C)O)=O)CC(N)=O)=O)CSSC[C@H](NC1=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N2[C@H](C(N[C@H](C(N[C@H](C(N3[C@H](C(N4[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N)=O)CC5=CC=C(O)C=C5)=O)[C@@H](C)O)=O)CC(N)=O)=O)CO)=O)=O)C(C)C)=O)CC(N)=O)=O)[C@@H](C)O)=O)CCC4)=O)CCC3)=O)CC(C)C)=O)[C@H](CC)C)=O)CCC2)=O)=O)CC6=CC=CC=C6)=O)CC(N)=O)=O)CC(N)=O)=O)CO)=O)CO)=O)CC7=CNC=N7)=O)C(C)C)=O)CC(C)C)=O)CC8=CC=CC=C8)=O)CC(N)=O)=O)C)=O)CC(C)C)=O)CCCNC(N)=N)=O)CCC(N)=O)=O)[C@@H](C)O)=O)C)=O.OC(C(F)(F)F)=O.[F,Cl,Br,I]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Pramlintide TFA
Cat. No.:
HY-P0058A
Quantity:
MCE Japan Authorized Agent: